PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 167aa    MW: 18316.1 Da    PI: 11.5098
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00412.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.12e-123071849
                    HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     r+v fs  r+g++KKA   +v ++a  avi+fs+ gk y +
  Pahal.A00412.1 30 ERHVCFSEHRHGLFKKATKFCVRTGAHLAVIMFSPAGKPYSF 71
                    69***********************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.0E-101274IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.031275IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-161585IPR002100Transcription factor, MADS-box
PfamPF003192.5E-152971IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MAGGERKRKD TLGLQKIEIK RQAHRVPREE RHVCFSEHRH GLFKKATKFC VRTGAHLAVI  60
MFSPAGKPYS FGHPSVNATV ERNHDPGSYV PLARETTHPA VLYEYGSEGE RLAKAIQAGG  120
AAAGRARTVS EVRGRRRRRV PINNPNRGRG GLLCKILGGF IKNIGS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954705.21e-30PREDICTED: MADS-box protein FLOWERING LOCUS C-like
TrEMBLK3YYE91e-30K3YYE9_SETIT; Uncharacterized protein
STRINGSi019299m3e-30(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-18AGAMOUS-like 61